| Definition: | Container for the HUPO PSI TraML format for encoding selected reaction monitoring transitions and other target lists | ||||||||||||||||||||||||||||||||||||||||||||
| Type: | TraMLType | ||||||||||||||||||||||||||||||||||||||||||||
| Attributes: |
|
||||||||||||||||||||||||||||||||||||||||||||
| Subelements: |
|
||||||||||||||||||||||||||||||||||||||||||||
| Example Context: | <TraML version="0.9.4" xmlns="http://psi.hupo.org/ms/traml" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://psi.hupo.org/ms/traml TraML0.9.4.xsd">
<cvList>
<cv id="MS" fullName="Proteomics Standards Initiative Mass Spectrometry Ontology" version="2.31.0" URI="http://psidev.cvs.sourceforge.net/*checkout*/psidev/psi/psi-ms/mzML/controlledVocabulary/psi-ms.obo"/>
<cv id="UO" fullName="Unit Ontology" version="unknown" URI="http://obo.cvs.sourceforge.net/obo/obo/ontology/phenotype/unit.obo"/>
<cv id="UNIMOD" fullName="UNIMOD CV for modifications" version="unknown" URI="http://www.unimod.org/obo/unimod.obo"/>
</cvList>
<SourceFileList>
...
</TraML>
|
| Definition: | List of controlled vocabularies used in a TraML document | ||||||||
| Type: | cvListType | ||||||||
| Attributes: | none |
||||||||
| Subelements: |
|
||||||||
| Example Context: | <cvList> <cv id="MS" fullName="Proteomics Standards Initiative Mass Spectrometry Ontology" version="2.31.0" URI="http://psidev.cvs.sourceforge.net/*checkout*/psidev/psi/psi-ms/mzML/controlledVocabulary/psi-ms.obo"/> <cv id="UO" fullName="Unit Ontology" version="unknown" URI="http://obo.cvs.sourceforge.net/obo/obo/ontology/phenotype/unit.obo"/> <cv id="UNIMOD" fullName="UNIMOD CV for modifications" version="unknown" URI="http://www.unimod.org/obo/unimod.obo"/> </cvList> |
| Definition: | List and descriptions of the source files this TraML document was generated or derived from | ||||||||
| Type: | SourceFileListType | ||||||||
| Attributes: | none |
||||||||
| Subelements: |
|
||||||||
| Example Context: | <SourceFileList>
<SourceFile id="sf1" name="OneTransition.tsv" location="file:///F:/data/Exp01">
<cvParam cvRef="MS" accession="MS:1000914" name="tab delimited text file" value=""/>
<cvParam cvRef="MS" accession="MS:1000569" name="SHA-1" value="71be39fb2700ab2f3c8b2234b91274968b6899b1"/>
</SourceFile>
</SourceFileList>
|
| Definition: | List of contacts referenced in the generation or validation of transitions | ||||||||
| Type: | ContactListType | ||||||||
| Attributes: | none |
||||||||
| Subelements: |
|
||||||||
| Example Context: | <ContactList>
<Contact id="CS">
<cvParam cvRef="MS" accession="MS:1000586" name="contact name" value="Eric Deutsch"/>
<cvParam cvRef="MS" accession="MS:1000590" name="contact organization" value="Institute for Systems Biology"/>
<cvParam cvRef="MS" accession="MS:1000587" name="contact address" value="1441 NE 34th St, Seattle WA 98103, USA"/>
<cvParam cvRef="MS" accession="MS:1000588" name="contact URL" value="http://www.systemsbiology.org/"/>
<cvParam cvRef="MS" accession="MS:1000589" name="contact email" value="example@systemsbiology.org"/>
...
</ContactList>
|
| Definition: | List of publications from which the transitions were collected or wherein they are published | ||||||||
| Type: | PublicationListType | ||||||||
| Attributes: | none |
||||||||
| Subelements: |
|
||||||||
| Example Context: | <PublicationList>
<Publication id="PMID12748199">
<cvParam cvRef="MS" accession="MS:1000879" name="PubMed identifier" value="12748199"/>
</Publication>
</PublicationList>
|
| Definition: | List of instruments on which transitions are validated | ||||||||
| Type: | InstrumentListType | ||||||||
| Attributes: | none |
||||||||
| Subelements: |
|
||||||||
| Example Context: | <InstrumentList>
<Instrument id="LCQ_Deca">
<cvParam cvRef="MS" accession="MS:1000554" name="LCQ Deca"/>
</Instrument>
<Instrument id="QTRAP">
<cvParam cvRef="MS" accession="MS:1000870" name="4000 QTRAP"/>
</Instrument>
...
</InstrumentList>
|
| Definition: | List of software packages used in the generation of one of more transitions described in the document | ||||||||
| Type: | SoftwareListType | ||||||||
| Attributes: | none |
||||||||
| Subelements: |
|
||||||||
| Example Context: | <SoftwareList>
<Software id="MaRiMba" version="1.0">
<cvParam cvRef="MS" accession="MS:1000872" name="MaRiMba"/>
</Software>
<Software id="SSRCalc3.0" version="3.0">
<cvParam cvRef="MS" accession="MS:1000874" name="SSRCalc"/>
</Software>
...
</SoftwareList>
|
| Definition: | List of proteins for which one or more transitions are intended to identify | ||||||||
| Type: | ProteinListType | ||||||||
| Attributes: | none |
||||||||
| Subelements: |
|
||||||||
| Example Context: | <ProteinList>
<Protein id="Q12149">
<cvParam cvRef="MS" accession="MS:1000885" name="protein accession" value="Q00613"/>
<cvParam cvRef="MS" accession="MS:1000883" name="protein short name" value="HSF 1"/>
<cvParam cvRef="MS" accession="MS:1000886" name="protein name" value="Heat shock factor protein 1"/>
<Sequence>MSTEMETKAEDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDNGKE</Sequence>
</Protein>
...
</ProteinList>
|
| Definition: | List of compounds (including peptides) for which one or more transitions are intended to identify | ||||||||||||||||
| Type: | CompoundListType | ||||||||||||||||
| Attributes: | none |
||||||||||||||||
| Subelements: |
|
||||||||||||||||
| Example Context: | <CompoundList>
<Peptide id="ADTHFLLNIYDQLR-M1" sequence="ADTHFLLNIYDQLR">
<cvParam cvRef="MS" accession="MS:1000891" name="heavy labeled peptide"/>
<cvParam cvRef="MS" accession="MS:1000893" name="peptide group label" value="1"/>
<cvParam cvRef="MS" accession="MS:1000863" name="predicted pI" value="5.22"/>
<cvParam cvRef="MS" accession="MS:1001117" name="theoretical mass" value="1189.22" unitCvRef="UO" unitAccession="UO:0000221" unitName="dalton"/>
<ProteinRef ref="Q12149"/>
...
</CompoundList>
|
| Definition: | List of transitions | ||||||||
| Type: | TransitionListType | ||||||||
| Attributes: | none |
||||||||
| Subelements: |
|
||||||||
| Example Context: | <TransitionList>
<Transition id="ADTHFLLNIYDQLR-M1-T1" peptideRef="ADTHFLLNIYDQLR-M1">
<Precursor>
<cvParam cvRef="MS" accession="MS:1000827" name="isolation window target m/z" value="862.9467" unitCvRef="MS" unitAccession="MS:1000040" unitName="m/z"/>
<cvParam cvRef="MS" accession="MS:1000041" name="charge state" value="2"/>
</Precursor>
<Product>
...
</TransitionList>
|
| Definition: | List of precursor m/z targets to include or exclude | ||||||||||||||||
| Type: | TargetListType | ||||||||||||||||
| Attributes: | none |
||||||||||||||||
| Subelements: |
|
||||||||||||||||
| Example Context: | <TargetList>
<cvParam cvRef="MS" accession="MS:1000920" name="includes supersede excludes"/>
<TargetIncludeList>
<Target id="PEPTIDEC2+" peptideRef="PEPTIDEC">
<Precursor>
<cvParam cvRef="MS" accession="MS:1000827" name="isolation window target m/z" value="862.9467" unitCvRef="MS" unitAccession="MS:1000040" unitName="m/z"/>
<cvParam cvRef="MS" accession="MS:1000041" name="charge state" value="2"/>
...
</TargetList>
|
||||||||||||||||
| cvParam Mapping Rules: | Path /TraML/TargetList MUST supply a *child* term of MS:1000919 (target inclusion exclusion priority) only once e.g.: MS:1000920 (includes supersede excludes) e.g.: MS:1000921 (excludes supersede includes) |
||||||||||||||||
| Example cvParams: | <cvParam cvRef="MS" accession="MS:1000920" name="includes supersede excludes"/> |
| Definition: | Controlled vocabulary used in a TraML document | ||||||||||||||||||||
| Type: | cvType | ||||||||||||||||||||
| Attributes: |
|
||||||||||||||||||||
| Subelements: | none |
||||||||||||||||||||
| Example Context: | <cv id="MS" fullName="Proteomics Standards Initiative Mass Spectrometry Ontology" version="2.31.0" URI="http://psidev.cvs.sourceforge.net/*checkout*/psidev/psi/psi-ms/mzML/controlledVocabulary/psi-ms.obo"/> |
| Definition: | Description of the source file, including location and type. | ||||||||||||||||
| Type: | SourceFileType | ||||||||||||||||
| Attributes: |
|
||||||||||||||||
| Subelements: |
|
||||||||||||||||
| Example Context: | <SourceFile id="sf1" name="OneTransition.tsv" location="file:///F:/data/Exp01"> <cvParam cvRef="MS" accession="MS:1000914" name="tab delimited text file" value=""/> <cvParam cvRef="MS" accession="MS:1000569" name="SHA-1" value="71be39fb2700ab2f3c8b2234b91274968b6899b1"/> </SourceFile> |
||||||||||||||||
| cvParam Mapping Rules: | Path /TraML/SourceFileList/SourceFile MAY supply a *child* term of MS:1000561 (data file checksum type) only once e.g.: MS:1000568 (MD5) e.g.: MS:1000569 (SHA-1) MUST supply term MS:1001459 (file format) or any of its children only once e.g.: MS:1000526 (Waters raw file) e.g.: MS:1000562 (ABI WIFF file) e.g.: MS:1000563 (Thermo RAW file) e.g.: MS:1000564 (PSI mzData file) e.g.: MS:1000565 (Micromass PKL file) e.g.: MS:1000566 (ISB mzXML file) e.g.: MS:1000567 (Bruker/Agilent YEP file) e.g.: MS:1000584 (mzML file) e.g.: MS:1000613 (DTA file) e.g.: MS:1000614 (ProteinLynx Global Server mass spectrum XML file) et al. |
||||||||||||||||
| Example cvParams: | <cvParam cvRef="MS" accession="MS:1000914" name="tab delimited text file" value=""/> <cvParam cvRef="MS" accession="MS:1000569" name="SHA-1" value="71be39fb2700ab2f3c8b2234b91274968b6899b1"/> |
| Definition: | Contact person referenced in the generation or validation of transitions | ||||||||
| Type: | ContactType | ||||||||
| Attributes: |
|
||||||||
| Subelements: |
|
||||||||
| Example Context: | <Contact id="CS"> <cvParam cvRef="MS" accession="MS:1000586" name="contact name" value="Eric Deutsch"/> <cvParam cvRef="MS" accession="MS:1000590" name="contact organization" value="Institute for Systems Biology"/> <cvParam cvRef="MS" accession="MS:1000587" name="contact address" value="1441 NE 34th St, Seattle WA 98103, USA"/> <cvParam cvRef="MS" accession="MS:1000588" name="contact URL" value="http://www.systemsbiology.org/"/> <cvParam cvRef="MS" accession="MS:1000589" name="contact email" value="example@systemsbiology.org"/> </Contact> |
||||||||
| cvParam Mapping Rules: | Path /TraML/ContactList/Contact MAY supply a *child* term of MS:1000585 (contact person attribute) one or more times e.g.: MS:1000586 (contact name) e.g.: MS:1000587 (contact address) e.g.: MS:1000588 (contact URL) e.g.: MS:1000589 (contact email) e.g.: MS:1000590 (contact organization) e.g.: MS:1001267 (software vendor) e.g.: MS:1001268 (programmer) e.g.: MS:1001269 (instrument vendor) e.g.: MS:1001270 (lab personnel) e.g.: MS:1001271 (researcher) MUST supply term MS:1000590 (contact organization) only once MUST supply term MS:1000586 (contact name) only once |
||||||||
| Example cvParams: | <cvParam cvRef="MS" accession="MS:1000586" name="contact name" value="Eric Deutsch"/> <cvParam cvRef="MS" accession="MS:1000590" name="contact organization" value="Institute for Systems Biology"/> <cvParam cvRef="MS" accession="MS:1000587" name="contact address" value="1441 NE 34th St, Seattle WA 98103, USA"/> <cvParam cvRef="MS" accession="MS:1000588" name="contact URL" value="http://www.systemsbiology.org/"/> <cvParam cvRef="MS" accession="MS:1000589" name="contact email" value="example@systemsbiology.org"/> |
| Definition: | Reference to a publication in which one or more transitions were published | ||||||||
| Type: | PublicationType | ||||||||
| Attributes: |
|
||||||||
| Subelements: |
|
||||||||
| Example Context: | <Publication id="PMID12748199"> <cvParam cvRef="MS" accession="MS:1000879" name="PubMed identifier" value="12748199"/> </Publication> |
||||||||
| cvParam Mapping Rules: | Path /TraML/PublicationList/Publication
MUST supply term MS:1000879 (PubMed identifier) only once
|
||||||||
| Example cvParams: | <cvParam cvRef="MS" accession="MS:1000879" name="PubMed identifier" value="12748199"/> |
| Definition: | Instrument on which transitions are validated | ||||||||
| Type: | InstrumentType | ||||||||
| Attributes: |
|
||||||||
| Subelements: |
|
||||||||
| Example Context: | <Instrument id="LCQ_Deca"> <cvParam cvRef="MS" accession="MS:1000554" name="LCQ Deca"/> </Instrument> |
||||||||
| cvParam Mapping Rules: | Path /TraML/InstrumentList/Instrument MUST supply a *child* term of MS:1000031 (instrument model) only once e.g.: MS:1000139 (4000 Q TRAP) e.g.: MS:1000140 (4700 Proteomics Analyzer) e.g.: MS:1000141 (apex IV) e.g.: MS:1000142 (apex Q) e.g.: MS:1000143 (API 150EX) e.g.: MS:1000144 (API 150EX Prep) e.g.: MS:1000145 (API 2000) e.g.: MS:1000146 (API 3000) e.g.: MS:1000147 (API 4000) e.g.: MS:1000148 (autoflex II) et al. |
||||||||
| Example cvParams: | <cvParam cvRef="MS" accession="MS:1000554" name="LCQ Deca"/> <cvParam cvRef="MS" accession="MS:1000870" name="4000 QTRAP"/> |
| Definition: | Description of a software package used in the generation of one or more transitions described in the document | ||||||||||||
| Type: | SoftwareType | ||||||||||||
| Attributes: |
|
||||||||||||
| Subelements: |
|
||||||||||||
| Example Context: | <Software id="SSRCalc3.0" version="3.0"> <cvParam cvRef="MS" accession="MS:1000874" name="SSRCalc"/> </Software> |
||||||||||||
| cvParam Mapping Rules: | Path /TraML/SoftwareList/Software MUST supply a *child* term of MS:1000531 (software) only once e.g.: MS:1000532 (Xcalibur) e.g.: MS:1000533 (Bioworks) e.g.: MS:1000534 (MassLynx) e.g.: MS:1000535 (FlexAnalysis) e.g.: MS:1000536 (Data Explorer) e.g.: MS:1000537 (4700 Explorer) e.g.: MS:1000538 (massWolf) e.g.: MS:1000539 (Voyager Biospectrometry Workstation System) e.g.: MS:1000540 (FlexControl) e.g.: MS:1000541 (ReAdW) et al. |
||||||||||||
| Example cvParams: | <cvParam cvRef="MS" accession="MS:1000872" name="MaRiMba"/> <cvParam cvRef="MS" accession="MS:1000874" name="SSRCalc"/> <cvParam cvRef="MS" accession="MS:1000922" name="Skyline"/> |
| Definition: | Protein for which one or more transitions are intended to identify | ||||||||||||
| Type: | ProteinType | ||||||||||||
| Attributes: |
|
||||||||||||
| Subelements: |
|
||||||||||||
| Example Context: | <Protein id="ENSP00000332698"> <cvParam cvRef="MS" accession="MS:1000885" name="protein accession" value="ENSP00000332698"/> <cvParam cvRef="MS" accession="MS:1000883" name="protein short name" value="HSF 1"/> <cvParam cvRef="MS" accession="MS:1000886" name="protein name" value="Heat shock factor protein 1"/> <Sequence>MSTEMETKAEDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDNGKEELISNSSDALDKI</Sequence> </Protein> |
||||||||||||
| cvParam Mapping Rules: | Path /TraML/ProteinList/Protein MAY supply a *child* term of MS:1000884 (protein attribute) one or more times e.g.: MS:1000883 (protein short name) e.g.: MS:1000885 (protein accession) e.g.: MS:1000886 (protein name) |
||||||||||||
| Example cvParams: | <cvParam cvRef="MS" accession="MS:1000885" name="protein accession" value="Q00613"/> <cvParam cvRef="MS" accession="MS:1000883" name="protein short name" value="HSF 1"/> <cvParam cvRef="MS" accession="MS:1000886" name="protein name" value="Heat shock factor protein 1"/> |
| Definition: | Controlled vocabulary term adding information to the parent term | ||||||||||||||||||||||||||||||||
| Type: | cvParamType | ||||||||||||||||||||||||||||||||
| Attributes: |
|
||||||||||||||||||||||||||||||||
| Subelements: | none |
||||||||||||||||||||||||||||||||
| Example Context: | <cvParam cvRef="MS" accession="MS:1000042" name="peak intensity" value="4072" unitCvRef="MS" unitAccession="MS:1000905" unitName="percent of base peak times 100"/> |
| Definition: | Peptide for which one or more transitions are intended to identify | ||||||||||||||||||||||||
| Type: | PeptideType | ||||||||||||||||||||||||
| Attributes: |
|
||||||||||||||||||||||||
| Subelements: |
|
||||||||||||||||||||||||
| Example Context: | <Peptide id="ADTHFLLNIYDQLR-M1" sequence="ADTHFLLNIYDQLR"> <cvParam cvRef="MS" accession="MS:1000891" name="heavy labeled peptide"/> <cvParam cvRef="MS" accession="MS:1000893" name="peptide group label" value="1"/> <cvParam cvRef="MS" accession="MS:1000863" name="predicted pI" value="5.22"/> <cvParam cvRef="MS" accession="MS:1001117" name="theoretical mass" value="1189.22" unitCvRef="UO" unitAccession="UO:0000221" unitName="dalton"/> <ProteinRef ref="Q12149"/> <ProteinRef ref="ENSP00000332698"/> ... </Peptide> |
||||||||||||||||||||||||
| cvParam Mapping Rules: | Path /TraML/CompoundList/Peptide MAY supply term MS:1000863 (predicted isoelectric point) only once MAY supply term MS:1000893 (peptide group label) only once MAY supply term MS:1001117 (theoretical mass) only once MAY supply a *child* term of MS:1000890 (peptide labeling state) one or more times e.g.: MS:1000891 (heavy labeled peptide) e.g.: MS:1000892 (unlabeled peptide) |
||||||||||||||||||||||||
| Example cvParams: | <cvParam cvRef="MS" accession="MS:1000891" name="heavy labeled peptide"/> <cvParam cvRef="MS" accession="MS:1000893" name="peptide group label" value="1"/> <cvParam cvRef="MS" accession="MS:1000863" name="predicted pI" value="5.22"/> <cvParam cvRef="MS" accession="MS:1001117" name="theoretical mass" value="1189.22" unitCvRef="UO" unitAccession="UO:0000221" unitName="dalton"/> |
| Definition: | Chemical compound other than a peptide for which one or more transitions | ||||||||||||
| Type: | CompoundType | ||||||||||||
| Attributes: |
|
||||||||||||
| Subelements: |
|
||||||||||||
| Example Context: | <Compound id="glyoxylate">
<cvParam cvRef="MS" accession="MS:1001117" name="theoretical mass" value="423.39" unitCvRef="UO" unitAccession="UO:0000221" unitName="dalton"/>
<cvParam cvRef="MS" accession="MS:1000866" name="molecular formula" value="C2HO3"/>
<cvParam cvRef="MS" accession="MS:1000868" name="SMILES string" value="[CH](=[O])[C](=[O])[O-]"/>
<RetentionTimeList>
<RetentionTime>
<cvParam cvRef="MS" accession="MS:1000896" name="normalized retention time" value="22.34" unitCvRef="UO" unitAccession="UO:0000031" unitName="minute"/>
...
</Compound>
|
||||||||||||
| cvParam Mapping Rules: | Path /TraML/CompoundList/Compound MAY supply term MS:1000863 (predicted isoelectric point) only once MAY supply a *child* term of MS:1000864 (chemical compound formula) one or more times e.g.: MS:1000865 (empirical formula) e.g.: MS:1000866 (molecular formula) e.g.: MS:1000867 (structural formula) e.g.: MS:1000868 (SMILES string) MAY supply term MS:1001117 (theoretical mass) only once |
||||||||||||
| Example cvParams: | <cvParam cvRef="MS" accession="MS:1001117" name="theoretical mass" value="423.39" unitCvRef="UO" unitAccession="UO:0000221" unitName="dalton"/> <cvParam cvRef="MS" accession="MS:1000866" name="molecular formula" value="C2HO3"/> <cvParam cvRef="MS" accession="MS:1000868" name="SMILES string" value="[CH](=[O])[C](=[O])[O-]"/> |
| Definition: | Information about a single transition for a peptide or other compound | ||||||||||||||||||||||||||||||||
| Type: | TransitionType | ||||||||||||||||||||||||||||||||
| Attributes: |
|
||||||||||||||||||||||||||||||||
| Subelements: |
|
||||||||||||||||||||||||||||||||
| Example Context: | <Transition id="ADTHFLLNIYDQLR-M1-T1" peptideRef="ADTHFLLNIYDQLR-M1">
<Precursor>
<cvParam cvRef="MS" accession="MS:1000827" name="isolation window target m/z" value="862.9467" unitCvRef="MS" unitAccession="MS:1000040" unitName="m/z"/>
<cvParam cvRef="MS" accession="MS:1000041" name="charge state" value="2"/>
</Precursor>
<Product>
<cvParam cvRef="MS" accession="MS:1000827" name="isolation window target m/z" value="1040.57" unitCvRef="MS" unitAccession="MS:1000040" unitName="m/z"/>
...
</Transition>
|
| Definition: | List of precursor m/z targets to include | ||||||||
| Type: | TargetIncludeListType | ||||||||
| Attributes: | none |
||||||||
| Subelements: |
|
||||||||
| Example Context: | <TargetIncludeList>
<Target id="PEPTIDEC2+" peptideRef="PEPTIDEC">
<Precursor>
<cvParam cvRef="MS" accession="MS:1000827" name="isolation window target m/z" value="862.9467" unitCvRef="MS" unitAccession="MS:1000040" unitName="m/z"/>
<cvParam cvRef="MS" accession="MS:1000041" name="charge state" value="2"/>
</Precursor>
<RetentionTime softwareRef="Skyline0.5">
...
</TargetIncludeList>
|
| Definition: | List of precursor m/z targets to exclude | ||||||||
| Type: | TargetExcludeListType | ||||||||
| Attributes: | none |
||||||||
| Subelements: |
|
||||||||
| Example Context: | <TargetExcludeList>
<Target id="PEPTIDEM3+" peptideRef="PEPTIDEM">
<Precursor>
<cvParam cvRef="MS" accession="MS:1000827" name="isolation window target m/z" value="698.3443" unitCvRef="MS" unitAccession="MS:1000040" unitName="m/z"/>
<cvParam cvRef="MS" accession="MS:1000041" name="charge state" value="3"/>
</Precursor>
</Target>
...
</TargetExcludeList>
|
| Definition: | Amino acid sequence of the protein |
| Type: | SequenceType |
| Attributes: | none |
| Subelements: | none |
| Example Context: | <Sequence>MSTEMETKAEDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDNGKEELISNSSDALDKI</Sequence> |
| Definition: | Reference to a protein which this peptide is intended to identify | ||||||||
| Type: | ProteinRefType | ||||||||
| Attributes: |
|
||||||||
| Subelements: | none |
||||||||
| Example Context: | <ProteinRef ref="ENSP00000332698"/> |
| Definition: | A molecule modification specification. If n modifications are present on the peptide, there should be n instances of the modification element. If multiple modifications are provided as cvParams, it is assumed the modification is ambiguous, i.e. one modification or the other. If no cvParams are provided it is assumed that the delta has not been matched to a known modification. | ||||||||||||||||
| Type: | ModificationType | ||||||||||||||||
| Attributes: |
|
||||||||||||||||
| Subelements: |
|
||||||||||||||||
| Example Context: | <Modification location="1" monoisotopicMassDelta="15.994919"> <cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/> </Modification> |
||||||||||||||||
| cvParam Mapping Rules: | Path /TraML/CompoundList/Peptide/Modification
MAY supply a *child* term of UNIMOD:0 (unimod root node) one or more times
|
||||||||||||||||
| Example cvParams: | <cvParam cvRef="UNIMOD" accession="UNIMOD:29" name="SMA"/> <cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/> |
| Definition: | List of retention time information entries | ||||||||
| Type: | RetentionTimeListType | ||||||||
| Attributes: | none |
||||||||
| Subelements: |
|
||||||||
| Example Context: | <RetentionTimeList>
<RetentionTime softwareRef="SSRCalc3.0">
<cvParam cvRef="MS" accession="MS:1000897" name="predicted retention time" value="44.07" unitCvRef="UO" unitAccession="UO:0000031" unitName="minute"/>
</RetentionTime>
<RetentionTime>
<cvParam cvRef="MS" accession="MS:1000896" name="normalized retention time" value="38.43" unitCvRef="UO" unitAccession="UO:0000031" unitName="minute"/>
<cvParam cvRef="MS" accession="MS:1000902" name="H-PINS retention time normalization standard"/>
...
</RetentionTimeList>
|
| Definition: | Information about empirical mass spectrometer observations of the peptide | ||||||||
| Type: | EvidenceType | ||||||||
| Attributes: | none |
||||||||
| Subelements: |
|
||||||||
| Example Context: | <Evidence> <cvParam cvRef="MS" accession="MS:1001100" name="confident peptide" value="6"/> </Evidence> |
||||||||
| cvParam Mapping Rules: | Path /TraML/CompoundList/Peptide/Evidence
MAY supply term MS:1001100 (confident peptide) only once
|
||||||||
| Example cvParams: | <cvParam cvRef="MS" accession="MS:1001100" name="confident peptide" value="6"/> |
| Definition: | Precursor (Q1) of the transition or target | ||||||||
| Type: | PrecursorType | ||||||||
| Attributes: | none |
||||||||
| Subelements: |
|
||||||||
| Example Context: | <Precursor> <cvParam cvRef="MS" accession="MS:1000827" name="isolation window target m/z" value="862.9467" unitCvRef="MS" unitAccession="MS:1000040" unitName="m/z"/> <cvParam cvRef="MS" accession="MS:1000041" name="charge state" value="2"/> </Precursor> |
||||||||
| cvParam Mapping Rules: | Path /TraML/TransitionList/Transition/Precursor MUST supply term MS:1000827 (isolation window target m/z) only once MAY supply term MS:1000041 (charge state) only once Path /TraML/TargetList/TargetIncludeList/Target/Precursor MUST supply term MS:1000827 (isolation window target m/z) only once MAY supply term MS:1000041 (charge state) only once Path /TraML/TargetList/TargetExcludeList/Target/Precursor MUST supply term MS:1000827 (isolation window target m/z) only once MAY supply term MS:1000041 (charge state) only once |
||||||||
| Example cvParams: | <cvParam cvRef="MS" accession="MS:1000827" name="isolation window target m/z" value="862.9467" unitCvRef="MS" unitAccession="MS:1000040" unitName="m/z"/> <cvParam cvRef="MS" accession="MS:1000041" name="charge state" value="2"/> |
| Definition: | Product (Q3) of the transition | ||||||||
| Type: | ProductType | ||||||||
| Attributes: | none |
||||||||
| Subelements: |
|
||||||||
| Example Context: | <Product> <cvParam cvRef="MS" accession="MS:1000827" name="isolation window target m/z" value="1040.57" unitCvRef="MS" unitAccession="MS:1000040" unitName="m/z"/> <cvParam cvRef="MS" accession="MS:1000041" name="charge state" value="1"/> </Product> |
||||||||
| cvParam Mapping Rules: | Path /TraML/TransitionList/Transition/Product MUST supply term MS:1000827 (isolation window target m/z) only once MAY supply term MS:1000041 (charge state) only once |
||||||||
| Example cvParams: | <cvParam cvRef="MS" accession="MS:1000827" name="isolation window target m/z" value="1040.57" unitCvRef="MS" unitAccession="MS:1000040" unitName="m/z"/> <cvParam cvRef="MS" accession="MS:1000041" name="charge state" value="1"/> |
| Definition: | List of possible interprations of fragment ions for a transition | ||||||||
| Type: | InterpretationListType | ||||||||
| Attributes: | none |
||||||||
| Subelements: |
|
||||||||
| Example Context: | <InterpretationList>
<Interpretation>
<cvParam cvRef="MS" accession="MS:1000926" name="product interpretation rank" value="1"/>
<cvParam cvRef="MS" accession="MS:1001220" name="frag: y ion"/>
<cvParam cvRef="MS" accession="MS:1000903" name="product ion series ordinal" value="8"/>
<cvParam cvRef="MS" accession="MS:1000904" name="product ion m/z delta" value="0.03" unitCvRef="MS" unitAccession="MS:1000040" unitName="m/z"/>
</Interpretation>
...
</InterpretationList>
|
| Definition: | Information about predicted or calibrated retention time | ||||||||
| Type: | RetentionTimeType | ||||||||
| Attributes: |
|
||||||||
| Subelements: |
|
||||||||
| Example Context: | <RetentionTime softwareRef="Skyline0.5"> <cvParam cvRef="MS" accession="MS:1000895" name="local retention time" value="40.02" unitCvRef="UO" unitAccession="UO:0000031" unitName="minute"/> <cvParam cvRef="MS" accession="MS:1000916" name="retention time window lower offset" value="3.0" unitCvRef="UO" unitAccession="UO:0000031" unitName="minute"/> <cvParam cvRef="MS" accession="MS:1000917" name="retention time window upper offset" value="3.0" unitCvRef="UO" unitAccession="UO:0000031" unitName="minute"/> </RetentionTime> |
||||||||
| cvParam Mapping Rules: | Path /TraML/TransitionList/Transition/RetentionTime/RetentionTime MAY supply a *child* term of MS:1000915 (retention time window attribute) one or more times e.g.: MS:1000916 (retention time window lower offset) e.g.: MS:1000917 (retention time window upper offset) MAY supply a *child* term of MS:1000901 (retention time normalization standard) only once e.g.: MS:1000902 (H-PINS retention time normalization standard) MUST supply term MS:1000895 (local retention time) only once Path /TraML/TargetList/Target/RetentionTime/RetentionTime MAY supply a *child* term of MS:1000915 (retention time window attribute) one or more times e.g.: MS:1000916 (retention time window lower offset) e.g.: MS:1000917 (retention time window upper offset) MAY supply a *child* term of MS:1000901 (retention time normalization standard) only once e.g.: MS:1000902 (H-PINS retention time normalization standard) MUST supply term MS:1000895 (local retention time) only once Path /TraML/CompoundList/Peptide/RetentionTimeList/RetentionTime MAY supply a *child* term of MS:1000915 (retention time window attribute) one or more times e.g.: MS:1000916 (retention time window lower offset) e.g.: MS:1000917 (retention time window upper offset) MAY supply a *child* term of MS:1000901 (retention time normalization standard) only once e.g.: MS:1000902 (H-PINS retention time normalization standard) MAY supply a *child* term of MS:1000894 (retention time) one or more times e.g.: MS:1000895 (local retention time) e.g.: MS:1000896 (normalized retention time) e.g.: MS:1000897 (predicted retention time) e.g.: MS:1000916 (retention time window lower offset) e.g.: MS:1000917 (retention time window upper offset) Path /TraML/CompoundList/Compound/RetentionTimeList/RetentionTime MAY supply a *child* term of MS:1000915 (retention time window attribute) one or more times e.g.: MS:1000916 (retention time window lower offset) e.g.: MS:1000917 (retention time window upper offset) MAY supply a *child* term of MS:1000901 (retention time normalization standard) only once e.g.: MS:1000902 (H-PINS retention time normalization standard) MAY supply a *child* term of MS:1000894 (retention time) one or more times e.g.: MS:1000895 (local retention time) e.g.: MS:1000896 (normalized retention time) e.g.: MS:1000897 (predicted retention time) e.g.: MS:1000916 (retention time window lower offset) e.g.: MS:1000917 (retention time window upper offset) |
||||||||
| Example cvParams: | <cvParam cvRef="MS" accession="MS:1000897" name="predicted retention time" value="44.07" unitCvRef="UO" unitAccession="UO:0000031" unitName="minute"/> <cvParam cvRef="MS" accession="MS:1000896" name="normalized retention time" value="38.43" unitCvRef="UO" unitAccession="UO:0000031" unitName="minute"/> <cvParam cvRef="MS" accession="MS:1000902" name="H-PINS retention time normalization standard"/> <cvParam cvRef="MS" accession="MS:1000895" name="local retention time" value="40.02" unitCvRef="UO" unitAccession="UO:0000031" unitName="minute"/> <cvParam cvRef="MS" accession="MS:1000916" name="retention time window lower offset" value="3.0" unitCvRef="UO" unitAccession="UO:0000031" unitName="minute"/> <cvParam cvRef="MS" accession="MS:1000917" name="retention time window upper offset" value="3.0" unitCvRef="UO" unitAccession="UO:0000031" unitName="minute"/> |
| Definition: | Information about a prediction for a suitable transition using some software | ||||||||||||
| Type: | PredictionType | ||||||||||||
| Attributes: |
|
||||||||||||
| Subelements: |
|
||||||||||||
| Example Context: | <Prediction softwareRef="MaRiMba" contactRef="CS"> <cvParam cvRef="MS" accession="MS:1000912" name="transition purported from an MS/MS spectrum on a different, specified instrument"/> <cvParam cvRef="MS" accession="MS:1000291" name="linear ion trap"/> <cvParam cvRef="MS" accession="MS:1000042" name="peak intensity" value="10000" unitCvRef="MS" unitAccession="MS:1000905" unitName="percent of base peak times 100"/> <cvParam cvRef="MS" accession="MS:1000906" name="peak intensity rank" value="1"/> <cvParam cvRef="MS" accession="MS:1000907" name="peak targeting suitability rank" value="1"/> </Prediction> |
||||||||||||
| cvParam Mapping Rules: | Path /TraML/TransitionList/Transition/Prediction MAY supply term MS:1000042 (peak intensity) only once MAY supply a *child* term of MS:1000909 (transition validation method) only once e.g.: MS:1000910 (transition optimized on specified instrument) e.g.: MS:1000911 (transition validated with an MS/MS spectrum on specified instrument) e.g.: MS:1000912 (transition purported from an MS/MS spectrum on a different, specified instrument) e.g.: MS:1000913 (transition predicted by informatic analysis) MAY supply term MS:1000443 (mass analyzer type) or any of its children only once e.g.: MS:1000078 (axial ejection linear ion trap) e.g.: MS:1000079 (fourier transform ion cyclotron resonance mass spectrometer) e.g.: MS:1000080 (magnetic sector) e.g.: MS:1000081 (quadrupole) e.g.: MS:1000082 (quadrupole ion trap) e.g.: MS:1000083 (radial ejection linear ion trap) e.g.: MS:1000084 (time-of-flight) e.g.: MS:1000254 (electrostatic energy analyzer) e.g.: MS:1000284 (stored waveform inverse fourier transform) e.g.: MS:1000288 (cyclotron) et al. MAY supply term MS:1000906 (peak intensity rank) only once MAY supply term MS:1000907 (peak targeting suitability rank) only once MAY supply term MS:1000031 (instrument model) or any of its children only once e.g.: MS:1000139 (4000 Q TRAP) e.g.: MS:1000140 (4700 Proteomics Analyzer) e.g.: MS:1000141 (apex IV) e.g.: MS:1000142 (apex Q) e.g.: MS:1000143 (API 150EX) e.g.: MS:1000144 (API 150EX Prep) e.g.: MS:1000145 (API 2000) e.g.: MS:1000146 (API 3000) e.g.: MS:1000147 (API 4000) e.g.: MS:1000148 (autoflex II) et al. |
||||||||||||
| Example cvParams: | <cvParam cvRef="MS" accession="MS:1000912" name="transition purported from an MS/MS spectrum on a different, specified instrument"/> <cvParam cvRef="MS" accession="MS:1000291" name="linear ion trap"/> <cvParam cvRef="MS" accession="MS:1000042" name="peak intensity" value="10000" unitCvRef="MS" unitAccession="MS:1000905" unitName="percent of base peak times 100"/> <cvParam cvRef="MS" accession="MS:1000906" name="peak intensity rank" value="1"/> <cvParam cvRef="MS" accession="MS:1000907" name="peak targeting suitability rank" value="1"/> |
| Definition: | List of insutrument configurations used in the validation or optimization of the transitions | ||||||||
| Type: | ConfigurationListType | ||||||||
| Attributes: | none |
||||||||
| Subelements: |
|
||||||||
| Example Context: | <ConfigurationList>
<Configuration instrumentRef="QTRAP" contactRef="CS">
<cvParam cvRef="MS" accession="MS:1000502" name="dwell time" value="0.12" unitCvRef="UO" unitAccession="UO:0000010" unitName="second"/>
<cvParam cvRef="MS" accession="MS:1000045" name="collision energy" value="26" unitCvRef="UO" unitAccession="UO:0000266" unitName="electronvolt"/>
<cvParam cvRef="MS" accession="MS:1000875" name="declustering potential" value="64" unitCvRef="UO" unitAccession="UO:0000218" unitName="volt"/>
<cvParam cvRef="MS" accession="MS:1000419" name="collision gas" value="argon"/>
<cvParam cvRef="MS" accession="MS:1000869" name="collision gas pressure" value="12" unitCvRef="UO" unitAccession="UO:0000110" unitName="pascal"/>
...
</ConfigurationList>
|
| Definition: | A peptide or compound that is to be included or excluded from a target list of precursor m/z values. | ||||||||||||||||||||
| Type: | TargetType | ||||||||||||||||||||
| Attributes: |
|
||||||||||||||||||||
| Subelements: |
|
||||||||||||||||||||
| Example Context: | <Target id="PEPTIDEC2+" peptideRef="PEPTIDEC">
<Precursor>
<cvParam cvRef="MS" accession="MS:1000827" name="isolation window target m/z" value="862.9467" unitCvRef="MS" unitAccession="MS:1000040" unitName="m/z"/>
<cvParam cvRef="MS" accession="MS:1000041" name="charge state" value="2"/>
</Precursor>
<RetentionTime softwareRef="Skyline0.5">
<cvParam cvRef="MS" accession="MS:1000895" name="local retention time" value="27.44" unitCvRef="UO" unitAccession="UO:0000031" unitName="minute"/>
...
</Target>
|
| Definition: | A possible interpration of the product ion for a transition | ||||||||
| Type: | InterpretationType | ||||||||
| Attributes: | none |
||||||||
| Subelements: |
|
||||||||
| Example Context: | <Interpretation>
<cvParam cvRef="MS" accession="MS:1000926" name="product interpretation rank" value="2"/>
<cvParam cvRef="MS" accession="MS:1001222" name="frag: b ion - H2O"/>
<cvParam cvRef="MS" accession="MS:1000903" name="product ion series ordinal" value="9"/>
<cvParam cvRef="MS" accession="MS:1000904" name="product ion m/z delta" value="-0.43" unitCvRef="MS" unitAccession="MS:1000040" unitName="m/z"/>
</Interpretation>
|
||||||||
| cvParam Mapping Rules: | Path /TraML/TransitionList/Transition/InterpretationList/Interpretation MUST supply a *child* term of MS:1001221 (fragmentation information) one or more times e.g.: MS:1000903 (product ion series ordinal) e.g.: MS:1000904 (product ion m/z delta) e.g.: MS:1000926 (product interpretation rank) e.g.: MS:1001220 (frag: y ion) e.g.: MS:1001222 (frag: b ion - H2O) e.g.: MS:1001223 (frag: y ion - H2O) e.g.: MS:1001224 (frag: b ion) e.g.: MS:1001225 (product ion m/z) e.g.: MS:1001226 (product ion intensity) e.g.: MS:1001227 (product ion m/z error) et al. MAY supply term MS:1000904 (product ion m/z delta) only once MUST supply term MS:1000926 (product interpretation rank) only once MUST supply term MS:1000903 (product ion series ordinal) only once |
||||||||
| Example cvParams: | <cvParam cvRef="MS" accession="MS:1000926" name="product interpretation rank" value="1"/> <cvParam cvRef="MS" accession="MS:1001220" name="frag: y ion"/> <cvParam cvRef="MS" accession="MS:1000903" name="product ion series ordinal" value="8"/> <cvParam cvRef="MS" accession="MS:1000904" name="product ion m/z delta" value="0.03" unitCvRef="MS" unitAccession="MS:1000040" unitName="m/z"/> <cvParam cvRef="MS" accession="MS:1001222" name="frag: b ion - H2O"/> |
| Definition: | Instrument configuration used in the validation or optimization of the transitions | ||||||||||||
| Type: | ConfigurationType | ||||||||||||
| Attributes: |
|
||||||||||||
| Subelements: |
|
||||||||||||
| Example Context: | <Configuration instrumentRef="QTRAP" contactRef="CS"> <cvParam cvRef="MS" accession="MS:1000502" name="dwell time" value="0.12" unitCvRef="UO" unitAccession="UO:0000010" unitName="second"/> <cvParam cvRef="MS" accession="MS:1000045" name="collision energy" value="26" unitCvRef="UO" unitAccession="UO:0000266" unitName="electronvolt"/> <cvParam cvRef="MS" accession="MS:1000875" name="declustering potential" value="64" unitCvRef="UO" unitAccession="UO:0000218" unitName="volt"/> <cvParam cvRef="MS" accession="MS:1000419" name="collision gas" value="argon"/> <cvParam cvRef="MS" accession="MS:1000869" name="collision gas pressure" value="12" unitCvRef="UO" unitAccession="UO:0000110" unitName="pascal"/> <cvParam cvRef="MS" accession="MS:1000876" name="cone voltage" value="1200" unitCvRef="UO" unitAccession="UO:0000218" unitName="volt"/> ... </Configuration> |
||||||||||||
| cvParam Mapping Rules: | Path /TraML/TargetList/TargetIncludeList/Target/ConfigurationList/Configuration MAY supply a *child* term of MS:1000482 (source attribute) one or more times e.g.: MS:1000392 (ionization efficiency) e.g.: MS:1000486 (source potential) e.g.: MS:1000843 (wavelength) e.g.: MS:1000844 (focus diameter x) e.g.: MS:1000845 (focus diameter y) e.g.: MS:1000846 (pulse energy) e.g.: MS:1000847 (pulse duration) e.g.: MS:1000848 (attenuation) e.g.: MS:1000849 (impact angle) e.g.: MS:1000850 (gas laser) et al. MAY supply a *child* term of MS:1000510 (precursor activation attribute) one or more times e.g.: MS:1000045 (collision energy) e.g.: MS:1000138 (percent collision energy) e.g.: MS:1000245 (charge stripping) e.g.: MS:1000412 (buffer gas) e.g.: MS:1000419 (collision gas) e.g.: MS:1000509 (activation energy) e.g.: MS:1000869 (collision gas pressure) MAY supply term MS:1000502 (dwell time) only once Path /TraML/TransitionList/Transition/ConfigurationList/Configuration MAY supply a *child* term of MS:1000482 (source attribute) one or more times e.g.: MS:1000392 (ionization efficiency) e.g.: MS:1000486 (source potential) e.g.: MS:1000843 (wavelength) e.g.: MS:1000844 (focus diameter x) e.g.: MS:1000845 (focus diameter y) e.g.: MS:1000846 (pulse energy) e.g.: MS:1000847 (pulse duration) e.g.: MS:1000848 (attenuation) e.g.: MS:1000849 (impact angle) e.g.: MS:1000850 (gas laser) et al. MAY supply a *child* term of MS:1000510 (precursor activation attribute) one or more times e.g.: MS:1000045 (collision energy) e.g.: MS:1000138 (percent collision energy) e.g.: MS:1000245 (charge stripping) e.g.: MS:1000412 (buffer gas) e.g.: MS:1000419 (collision gas) e.g.: MS:1000509 (activation energy) e.g.: MS:1000869 (collision gas pressure) MAY supply term MS:1000502 (dwell time) only once |
||||||||||||
| Example cvParams: | <cvParam cvRef="MS" accession="MS:1000502" name="dwell time" value="0.12" unitCvRef="UO" unitAccession="UO:0000010" unitName="second"/> <cvParam cvRef="MS" accession="MS:1000045" name="collision energy" value="26" unitCvRef="UO" unitAccession="UO:0000266" unitName="electronvolt"/> <cvParam cvRef="MS" accession="MS:1000875" name="declustering potential" value="64" unitCvRef="UO" unitAccession="UO:0000218" unitName="volt"/> <cvParam cvRef="MS" accession="MS:1000419" name="collision gas" value="argon"/> <cvParam cvRef="MS" accession="MS:1000869" name="collision gas pressure" value="12" unitCvRef="UO" unitAccession="UO:0000110" unitName="pascal"/> <cvParam cvRef="MS" accession="MS:1000876" name="cone voltage" value="1200" unitCvRef="UO" unitAccession="UO:0000218" unitName="volt"/> <cvParam cvRef="MS" accession="MS:1000880" name="interchannel delay" value="0.01" unitCvRef="UO" unitAccession="UO:0000010" unitName="second"/> <cvParam cvRef="MS" accession="MS:1000877" name="tube lens" value="23" unitCvRef="UO" unitAccession="UO:0000218" unitName="volt"/> |
| Definition: | Information about the state of validation of a transition on a given instrument model | ||||||||
| Type: | ValidationType | ||||||||
| Attributes: | none |
||||||||
| Subelements: |
|
||||||||
| Example Context: | <Validation>
<cvParam cvRef="MS" accession="MS:1000910" name="transition optimized on specified instrument"/>
<cvParam cvRef="MS" accession="MS:1000139" name="4000 Q TRAP"/>
<cvParam cvRef="MS" accession="MS:1000042" name="peak intensity" value="4072" unitCvRef="MS" unitAccession="MS:1000905" unitName="percent of base peak times 100"/>
<cvParam cvRef="MS" accession="MS:1000906" name="peak intensity rank" value="2"/>
<cvParam cvRef="MS" accession="MS:1000907" name="peak targeting suitability rank" value="1"/>
</Validation>
|
||||||||
| cvParam Mapping Rules: | Path /TraML/TransitionList/Transition/ConfigurationList/Configuration/Validation MAY supply term MS:1000042 (peak intensity) only once MAY supply a *child* term of MS:1000909 (transition validation method) only once e.g.: MS:1000910 (transition optimized on specified instrument) e.g.: MS:1000911 (transition validated with an MS/MS spectrum on specified instrument) e.g.: MS:1000912 (transition purported from an MS/MS spectrum on a different, specified instrument) e.g.: MS:1000913 (transition predicted by informatic analysis) MAY supply term MS:1000906 (peak intensity rank) only once MAY supply term MS:1000907 (peak targeting suitability rank) only once MAY supply term MS:1000031 (instrument model) or any of its children only once e.g.: MS:1000139 (4000 Q TRAP) e.g.: MS:1000140 (4700 Proteomics Analyzer) e.g.: MS:1000141 (apex IV) e.g.: MS:1000142 (apex Q) e.g.: MS:1000143 (API 150EX) e.g.: MS:1000144 (API 150EX Prep) e.g.: MS:1000145 (API 2000) e.g.: MS:1000146 (API 3000) e.g.: MS:1000147 (API 4000) e.g.: MS:1000148 (autoflex II) et al. |
||||||||
| Example cvParams: | <cvParam cvRef="MS" accession="MS:1000910" name="transition optimized on specified instrument"/> <cvParam cvRef="MS" accession="MS:1000139" name="4000 Q TRAP"/> <cvParam cvRef="MS" accession="MS:1000042" name="peak intensity" value="4072" unitCvRef="MS" unitAccession="MS:1000905" unitName="percent of base peak times 100"/> <cvParam cvRef="MS" accession="MS:1000906" name="peak intensity rank" value="2"/> <cvParam cvRef="MS" accession="MS:1000907" name="peak targeting suitability rank" value="1"/> |